Recombinant Human BTN2A2 Protein (33-262 aa), His-SUMO-tagged

• Cat.No.: BTN2A2-1093H
• Product Overview: Recombinant Human BTN2A2 Protein (33-262 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Description: Inhibits the proliferation of CD4 and CD8 T-cells activated by anti-CD3 antibodies, T-cell metabolism and IL2 and IFNG secretion.
• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 41.7 kDa
• Protein length: 33-262 aa
• AA Sequence: QFTVVGPANPILAMVGENTTLRCHLSPEKNAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRITFVSKDINRGSVALVIHNVTAQENGIYRCYFQEGRSYDEAILRLVVAGLGSKPLIEIKAQEDGSIWLECISGGWYPEPLTVWRDPYGEVVPALKEVSIADADGLFMVTTAVIIRDKYVRNVSCSVNNTLLGQEKETVIFIPESFMPSASPWMVALAVILTAS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: BTN2A2 butyrophilin, subfamily 2, member A2 [ Homo sapiens ]
• Official Symbol: BTN2A2
• Synonyms: BT2A2_HUMAN; BTF2; BTN2A2; butyrophilin 2
• Gene ID: 10385
• mRNA Refseq: NM_001197237.1
• Protein Refseq: NP_001184166.1
• MIM: 613591
• UniProt ID: Q8WVV5