Recombinant Human BTLA Protein, Fc-tagged
Cat.No. : | BTLA-609H |
Product Overview : | Recombinant human BTLA protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 289 |
Description : | This gene encodes a member of the immunoglobulin superfamily. The encoded protein contains a single immunoglobulin (Ig) domain and is a receptor that relays inhibitory signals to suppress the immune response. Alternative splicing results in multiple transcript variants. Polymorphisms in this gene have been associated with an increased risk of rheumatoid arthritis. |
Form : | Lyophilized |
Molecular Mass : | 38.7 kDa |
AA Sequence : | MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRRHQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | BTLA B and T lymphocyte associated [ Homo sapiens (human) ] |
Official Symbol | BTLA |
Synonyms | BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743; |
Gene ID | 151888 |
mRNA Refseq | NM_001085357 |
Protein Refseq | NP_001078826 |
MIM | 607925 |
UniProt ID | Q7Z6A9 |
◆ Recombinant Proteins | ||
BTLA-1148RAF647 | Active Recombinant Rat Btla Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
BTLA-8698MF | Recombinant Mouse Btla Protein, hFc-tagged, FITC conjugated | +Inquiry |
BTLA-609H | Recombinant Human BTLA Protein, Fc-tagged | +Inquiry |
BTLA-193H | Recombinant Human BTLA(Lys31-Leu150) Protein, C-mFc-tagged | +Inquiry |
BTLA-518H | Recombinant Human BTLA protein, His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTLA-732CCL | Recombinant Cynomolgus BTLA cell lysate | +Inquiry |
BTLA-1278MCL | Recombinant Mouse BTLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTLA Products
Required fields are marked with *
My Review for All BTLA Products
Required fields are marked with *
0
Inquiry Basket