Recombinant Human BTLA protein, Fc/His-tagged

• Cat.No.: BTLA-191H
• Product Overview: Recombinant Human BTLA(Lys31-Leu150) fused with Fc/His tag at C-terminal was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: Fc&His
• Protein Length: Lys31-Leu150
• Form: Lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4
• AA Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNI SFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTGKQNELSDTAGREINLVDDIEGRMDE PKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
• Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
• Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
• Shipping: The product is shipped at ambient temperature.

Gene Information

• Gene Name: BTLA B and T lymphocyte associated [ Homo sapiens ]
• Official Symbol: BTLA
• Synonyms: BTLA; B and T lymphocyte associated; B- and T-lymphocyte attenuator; BTLA1; CD272; B and T lymphocyte attenuator; B- and T-lymphocyte-associated protein; FLJ16065; MGC129743
• Gene ID: 151888
• mRNA Refseq: NM_001085357
• Protein Refseq: NP_001078826
• MIM: 607925
• UniProt ID: Q7Z6A9
• Chromosome Location: 3q13.2
• Pathway: Adaptive Immune System, organism-specific biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem
• Function: receptor activity