Recombinant Human BTG4 Protein, GST-tagged

• Cat.No.: BTG4-386H
• Product Overview: Human BTG4 full-length ORF ( AAH31045, 1 a.a. - 206 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein can induce G1 arrest in the cell cycle.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 48.4 kDa
• AA Sequence: MRDEIATTVFFVTRLVKKHDKLSKQQIEDFAEKLMTILFETYRSHWHSDCPSKGQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFEVCCRYGEKNHPFTVASFKGRWEEWELYQQISYAVSRASSDVSSGTSCDEESCSKEPRVIPKVSNPKSIYQVKSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BTG4 B-cell translocation gene 4 [ Homo sapiens ]
• Official Symbol: BTG4
• Synonyms: BTG4; B-cell translocation gene 4; protein BTG4; PC3B; protein PC3b; BTG family member 4; MGC33003
• Gene ID: 54766
• mRNA Refseq: NM_017589
• Protein Refseq: NP_060059
• MIM: 605673
• UniProt ID: Q9NY30