Recombinant Human BTG1 Protein, GST-tagged

• Cat.No.: BTG1-382H
• Product Overview: Human BTG1 full-length ORF ( AAH16759, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is a member of an anti-proliferative gene family that regulates cell growth and differentiation. Expression of this gene is highest in the G0/G1 phases of the cell cycle and downregulated when cells progressed through G1. The encoded protein interacts with several nuclear receptors, and functions as a coactivator of cell differentiation. This locus has been shown to be involved in a t(8;12)(q24;q22) chromosomal translocation in a case of B-cell chronic lymphocytic leukemia.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 44.55 kDa
• AA Sequence: MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BTG1 B-cell translocation gene 1, anti-proliferative [ Homo sapiens ]
• Official Symbol: BTG1
• Synonyms: BTG1; B-cell translocation gene 1, anti-proliferative; protein BTG1; B-cell translocation gene 1 protein
• Gene ID: 694
• mRNA Refseq: NM_001731
• Protein Refseq: NP_001722
• MIM: 109580
• UniProt ID: P62324