Recombinant Human BTG1 Protein, GST-tagged

Cat.No. : BTG1-382H
Product Overview : Human BTG1 full-length ORF ( AAH16759, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of an anti-proliferative gene family that regulates cell growth and differentiation. Expression of this gene is highest in the G0/G1 phases of the cell cycle and downregulated when cells progressed through G1. The encoded protein interacts with several nuclear receptors, and functions as a coactivator of cell differentiation. This locus has been shown to be involved in a t(8;12)(q24;q22) chromosomal translocation in a case of B-cell chronic lymphocytic leukemia.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 44.55 kDa
AA Sequence : MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEKPCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGSICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BTG1 B-cell translocation gene 1, anti-proliferative [ Homo sapiens ]
Official Symbol BTG1
Synonyms BTG1; B-cell translocation gene 1, anti-proliferative; protein BTG1; B-cell translocation gene 1 protein;
Gene ID 694
mRNA Refseq NM_001731
Protein Refseq NP_001722
MIM 109580
UniProt ID P62324

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BTG1 Products

Required fields are marked with *

My Review for All BTG1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon