Recombinant Human BTBD8 Protein, GST-tagged

• Cat.No.: BTBD8-374H
• Product Overview: Human BTBD8 full-length ORF ( NP_899065.1, 1 a.a. - 378 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 69.2 kDa
• AA Sequence: MARCGEGSAAPMVLLGSAGVCSKGLQRKGPCERRRLKATVSEQLSQDLLRLLREEFHTDVTFSVGCTLFKAHKAVLLARVPDFYFHTIGQTSNSLTNQEPIAVENVEALEFRTFLQIIYSSNRNIKNYEEEILRKKIMEIGISQKQLDISFPKCENSSDCSLQKHEIPEDISDRDDDFISNDNYDLEPASELGEDLLKLYVKPGCPDIDIFVDGKRFKAHRAILSARSSYFAAMLSGCWAESSQEYVTLQGISHVELNVMMHFIYGGTLDIPDKTNVGQILNMADMYGLEGLKEVAIYILRRDYCNFFQKPVPRTLTSILECLIIAHSVGVESLFADCMKWIVKHFARFWSERSFANIPPEIQKSCLNMLIQSLVNIT
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BTBD8 BTB (POZ) domain containing 8 [ Homo sapiens ]
• Official Symbol: BTBD8
• Synonyms: BTBD8; BTB (POZ) domain containing 8; BTB/POZ domain-containing protein 8; double BTB/POZ domain containing protein
• Gene ID: 284697
• mRNA Refseq: NM_183242
• Protein Refseq: NP_899065
• UniProt ID: Q5XKL5