Recombinant Human BTBD1 protein, His-tagged

Source :	E. coli
Species :	Human
Tag :	N-His
Protein length :	1-60 aa
Form :	The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence :	MASLGPAAAGEQASGAEAEPGPAGPPPPPSPSSLGPLLPLQREPLYNWQATKASLKERFA
Purity :	85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage :	Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution :	Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Name	BTBD1 BTB (POZ) domain containing 1 [ Homo sapiens ]
Official Symbol	BTBD1
Synonyms	BTBD1; BTB (POZ) domain containing 1; BTB/POZ domain-containing protein 1; BTB domain containing 1; HCV NS5A-transactivated protein 8; hepatitis C virus NS5A-transactivated protein 8; C15orf1; NS5ATP8;
Gene ID	53339
mRNA Refseq	NM_001011885
Protein Refseq	NP_001011885
MIM	608530
UniProt ID	Q9H0C5