Name: Recombinant Human BTAF1 Protein, GST-tagged
SKU: BTAF1-365H

Species :	Human
Source :	Wheat Germ
Tag :	GST
Description :	Initiation of transcription by RNA polymerase II requires the assistance of TATA box-binding protein (TBP; MIM 600075) and TBP-associated factors, or TAFs (e.g., TAF2B; MIM 604912), in 2 distinct complexes, TFIID and B-TFIID. The TFIID complex is composed of TBP and more than 8 TAFs. However, the majority of TBP is present in the B-TFIID complex, which is composed of TBP and TAFII170, also called TAF172, and has DNA-dependent ATPase activity.
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	36.74 kDa
AA Sequence :	NVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK
Quality Control Test :	12.5% SDS-PAGE Stained with Coomassie Blue.
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	BTAF1 BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1 homolog, S. cerevisiae) [ Homo sapiens ]
Official Symbol	BTAF1
Synonyms	BTAF1; BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1 homolog, S. cerevisiae); BTAF1 RNA polymerase II, B TFIID transcription factor associated, 170 kD (Mot1 homolog, S. cerevisiae); TATA-binding protein-associated factor 172; MOT1; TAF(II)170; TAF 172; TAF172; TAFII170; TBP-associated factor 172; ATP-dependent helicase BTAF1; B-TFIID transcription factor-associated 170 kDa subunit; KIAA0940; MGC138406;
Gene ID	9044
mRNA Refseq	NM_003972
Protein Refseq	NP_003963
MIM	605191
UniProt ID	O14981