Recombinant Human BSPRY Protein, GST-tagged

• Cat.No.: BSPRY-362H
• Product Overview: Human BSPRY full-length ORF ( AAH01477.1, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 47.8 kDa
• AA Sequence: MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BSPRY B-box and SPRY domain containing [ Homo sapiens ]
• Official Symbol: BSPRY
• Synonyms: BSPRY; B-box and SPRY domain containing; B box and SPRY domain-containing protein; FLJ20150; zetin 1; B-box and SPRY-domain containing protein
• Gene ID: 54836
• mRNA Refseq: NM_017688
• Protein Refseq: NP_060158
• UniProt ID: Q5W0U4