Recombinant Human BSG Protein, His-Tagged

• Cat.No.: BSG-013H
• Product Overview: Recombinant Human BSG protein(NP_001309172.1)(Glu138~Ala323), fused to His-tag at N-terminus, was expressed in HEK293F.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Glu138~Ala323
• Description: The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously expressed in various tissues. Multiple transcript variants encoding different isoforms have been found for this gene.
• Form: 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
• Molecular Mass: 27kd-33kDa as determined by SDS-PAGE reducing conditions.
• AA Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA
• Endotoxin: <1.0EU per 1µg (determined by the LAL method)
• Purity: > 90%
• Applications: Positive Control; Immunogen; SDS-PAGE; WB.
  If bio-activity of the protein is needed, please check active protein.
• Notes: The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures.
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles.
  Store at 2-8ºC for one month.
  Aliquot and store at -80ºC for 12 months.
• Reconstitution: Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.

Gene Information

• Gene Name: BSG basigin (Ok blood group) [ Homo sapiens (human) ]
• Official Symbol: BSG
• Synonyms: EMMPRIN; BSG; 5F7; M6; OK; TCSF; Basigin(Ok Blood Group); Collagenase stimulatory factor; OK blood group antigen; Tumor cell-derived collagenase stimulatory factor
• Gene ID: 682
• mRNA Refseq: NM_001322243.2
• Protein Refseq: NP_001309172.1
• MIM: 109480
• UniProt ID: P35613