Recombinant Human BSG Protein, C-His-tagged
Cat.No. : | BSG-134H |
Product Overview : | Recombinant Human BSG Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Basigin (EMMPRIN, CD147) is a type I integral membrane receptor protein belonging to the immunoglobulin superfamily. Basigin is a glycosylated protein with four known isoforms, of which isoform 2 is the most abundantly expressed. Multiple functions have been ascribed to Basigin; foremost among these is stimulating the secretion of extracellular matrix metalloproteinases by adjacent fibroblasts, a function which has been implicated in promoting tumor progression. Research studies have shown that Basigin is overexpressed by many tumor cells, and its expression level may correlate with tumor malignancy. A recent study identified the BASIGIN gene as a regulatory target of Slug, suggesting a role for Basigin in the process of epithelial-mesenchymal transition. Basigin has also been identified as a marker for a subset of highly suppressive regulatory T cells, and as an obligate receptor for the malarial parasite Plasmodium falciparum on human erythrocytes. |
Molecular Mass : | ~20 kDa |
AA Sequence : | EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | BSG basigin (Ok blood group) [ Homo sapiens (human) ] |
Official Symbol | BSG |
Synonyms | BSG; basigin (Ok blood group); basigin (OK blood group) , OK; basigin; CD147; EMMPRIN; CD147 antigen; OK blood group antigen; collagenase stimulatory factor; leukocyte activation antigen M6; extracellular matrix metalloproteinase inducer; tumor cell-derived collagenase stimulatory factor; M6; OK; 5F7; TCSF; |
Gene ID | 682 |
mRNA Refseq | NM_001728 |
Protein Refseq | NP_001719 |
MIM | 109480 |
UniProt ID | P35613 |
◆ Recombinant Proteins | ||
BSG-1414H | Active Recombinant Human BSG protein, Fc-tagged | +Inquiry |
Bsg-612R | Recombinant Rat Bsg Protein, His-tagged | +Inquiry |
BSG-613H | Recombinant Human BSG protein, mFc-tagged | +Inquiry |
Bsg-610M | Recombinant Mouse Bsg Protein, His-tagged | +Inquiry |
BSG-039H | Recombinant Human BSG Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BSG-2512MCL | Recombinant Mouse BSG cell lysate | +Inquiry |
BSG-2726HCL | Recombinant Human BSG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BSG Products
Required fields are marked with *
My Review for All BSG Products
Required fields are marked with *
0
Inquiry Basket