Recombinant Human BSG, GST-tagged

• Cat.No.: BSG-105H
• Product Overview: Human BSG full-length ORF ( 1 a.a. - 269 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 55.6 kDa
• AA Sequence: MAAALFVLLGFALLGTHGASGAAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFK VDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINE GETAMLVCKSESVPPVTDWAWYKITDSEDKA LMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVT IIFIYEKRRKPE DVLDDDDAGSAPLKSSGQHQNDKGKNVRQRNSS
• Applications: ELISA; WB-Re; AP; Array
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BSG basigin (Ok blood group) [ Homo sapiens (human) ]
• Official Symbol: BSG
• Synonyms: BSG; M6; OK; 5F7; TCSF; CD147; EMMPRIN; basigin (Ok blood group); basigin; CD147 antigen; OK blood group antigen; collagenase stimulatory factor; leukocyte activation antigen M6; extracellular matrix metalloproteinase inducer; tumor cell-derived collagenase stimulatory factor
• Gene ID: 682
• mRNA Refseq: NM_198589
• Protein Refseq: NP_940991
• MIM: 109480
• UniProt ID: P35613
• Chromosome Location: 19p13.3
• Pathway: Basigin interactions; Cell surface interactions at the vascular wall; Integrin cell surface interactions
• Function: mannose binding; protein binding