Recombinant Human BRSK2 Protein, GST-tagged

• Cat.No.: BRSK2-351H
• Product Overview: Human BRSK2 full-length ORF ( AAH24291.1, 1 a.a. - 170 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 44.9 kDa
• AA Sequence: MSNLTPESSPELAKKSWFGNFISLEKEEQIFVVIKDKPLSSIKADIVHAFLSIPSLSHSVISQTSFRAEYKATGGPAVFQKPVKFQVDITYTEGGEAQKENGIYSVTFTLLSGPSRRFKRVVETIQAQLLSTHDPPAAQHLSEPPPPAPGLSWGAGLKGQKVATSYESSL
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BRSK2 BR serine/threonine kinase 2 [ Homo sapiens ]
• Official Symbol: BRSK2
• Synonyms: BRSK2; BR serine/threonine kinase 2; C11orf7, chromsosome 11 open reading frame 7 , STK29; serine/threonine-protein kinase BRSK2; PEN11B; serine/threonine kinase 29; protein kinase SAD1B; brain-selective kinase 2; serine/threonine-protein kinase 29; BR serine/threonine-protein kinase 2; serine/threonine-protein kinase SAD-A; brain-specific serine/threonine-protein kinase 2; SAD1; STK29; C11orf7; FLJ41362
• Gene ID: 9024
• mRNA Refseq: NM_001256627
• Protein Refseq: NP_001243556
• MIM: 609236
• UniProt ID: Q8IWQ3