Recombinant Human BRI3 Protein

• Cat.No.: BRI3-339H
• Product Overview: Human BRI3 full-length ORF (ADR82701.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 13.8 kDa
• AA Sequence: MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHYPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: BRI3 brain protein I3 [ Homo sapiens ]
• Official Symbol: BRI3
• Synonyms: Brain protein I3; BRI3; BRI3_HUMAN; pRGR2; I3
• Gene ID: 25798
• mRNA Refseq: NM_015379.4
• Protein Refseq: NP_056194.1
• UniProt ID: O95415