Recombinant Full Length Human BRI3 Protein

• Cat.No.: BRI3-3796HF
• Product Overview: Human BRI3 full-length ORF (ADR82701.1) recombinant protein without tag.

Specification

• Description: Predicted to enable ribosomal large subunit binding activity. Involved in negative regulation of mitochondrial translation and ribosomal large subunit biogenesis. Located in cytosol and mitochondrion. Colocalizes with mitochondrial large ribosomal subunit.
• Source: In Vitro Cell Free System
• Species: Human
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 13.8 kDa
• Protein length: 757 amino acids
• AA Sequence: MDHKPLLQERPPAYNLEAGQGDYACGPHGYGAIPAAPPPPPYPYLVTGIPTHYPRVYNIHSRTVTRYPANSIVVVGGCPVCRVGVLEDCFTFLGIFLAIILFPFGFICCFALRKRRCPNCGATFA
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: BRI3 brain protein I3 [ Homo sapiens ]
• Official Symbol: BRI3
• Synonyms: Brain protein I3; BRI3; BRI3_HUMAN; pRGR2; I3
• Gene ID: 25798
• mRNA Refseq: NM_015379.4
• Protein Refseq: NP_056194.1
• MIM: 615628
• UniProt ID: O95415