Recombinant Human BRF1 Protein, GST-tagged

• Cat.No.: BRF1-336H
• Product Overview: Human BRF1 full-length ORF ( AAH16743, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Two alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. Other transcript variants are possible, but their full-length natures have not been completely characterized.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 48.62 kDa
• AA Sequence: MTGRVCRGCGGTDIELDAARGDTVCTACGSVLEDNIIMSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYPVCRTEGTPHMLLDLSDLLQVDSLRPASFPTWGCDLGVVTRVVTGVYPRCLHASQWPVCAACPVRKFWSVG
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BRF1 BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: BRF1
• Synonyms: BRF1; BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae); GTF3B, TAF3B2, TAF3C, TATA box binding protein (TBP) associated factor, RNA polymerase III, GTF3B subunit 2; transcription factor IIIB 90 kDa subunit; BRF; hBRF; TFIIIB90; B - related factor 1; general transcription factor IIIB, 90kD subunit; TBP - associated factor, RNA polymerase III, 90kD; TATA box binding protein (TBP)-associated factor 3C; TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3B subunit 2; BRF-1; GTF3B; TAF3C; TAF3B2; TF3B90; TAFIII90; FLJ42674; FLJ43034; MGC105048
• Gene ID: 2972
• mRNA Refseq: NM_001242786
• Protein Refseq: NP_001229715
• MIM: 604902
• UniProt ID: Q92994