Recombinant Human BRCA1 Protein, GST-tagged

• Cat.No.: BRCA1-325H
• Product Overview: Human BRCA1 full-length ORF ( NP_009237.1, 1 a.a. - 59 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a nuclear phosphoprotein that plays a role in maintaining genomic stability, and it also acts as a tumor suppressor. The encoded protein combines with other tumor suppressors, DNA damage sensors, and signal transducers to form a large multi-subunit protein complex known as the BRCA1-associated genome surveillance complex (BASC). This gene product associates with RNA polymerase II, and through the C-terminal domain, also interacts with histone deacetylase complexes. This protein thus plays a role in transcription, DNA repair of double-stranded breaks, and recombination. Mutations in this gene are responsible for approximately 40% of inherited breast cancers and more than 80% of inherited breast and ovarian cancers. Alternative splicing plays a role in modulating the subcellular localization and physiological function of this gene. Many alternatively spliced transcript variants, some of which are disease-associated mutations, have been described for this gene, but the full-length natures of only some of these variants has been described. A related pseudogene, which is also located on chromosome 17, has been identified.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 33.1 kDa
• AA Sequence: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKVLLCCPSWSTVVRS
• Quality Control Test: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BRCA1 breast cancer 1, early onset [ Homo sapiens ]
• Official Symbol: BRCA1
• Synonyms: BRCA1; breast cancer 1, early onset; breast cancer type 1 susceptibility protein; BRCA1/BRCA2 containing complex; subunit 1; BRCC1; PPP1R53; protein phosphatase 1; regulatory subunit 53; RNF53; RING finger protein 53; BRCA1/BRCA2-containing complex, subunit 1; protein phosphatase 1, regulatory subunit 53; breast and ovarian cancer susceptibility protein 1; breast and ovarian cancer sususceptibility protein 1; IRIS; PSCP; BRCAI; PNCA4; BROVCA1
• Gene ID: 672
• mRNA Refseq: NM_007294
• Protein Refseq: NP_009225
• MIM: 113705
• UniProt ID: P38398