Active Recombinant Human BRAF Protein, GST-tagged
Cat.No. : | BRAF-321H |
Product Overview : | Human BRAF partial ORF ( NP_004324, 346 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Bio-activity : | The activity was determined by ELISA. The enzyme was incubated with GST-fused substrate protein, and after stopping kinase reaction by EDTA, the reaction solution was transferred into glutathione-coated plate. Phosphorylation was detected by anti-phospho antibody and HRP-labeled anti-rabbit IgG (or HRP-labeled anti-mouse IgG).Substrate : MAP2K1 [inactive mutant]. ATP: 100 µM. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD |
Quality Control Test : | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BRAF v-raf murine sarcoma viral oncogene homolog B1 [ Homo sapiens ] |
Official Symbol | BRAF |
Synonyms | BRAF; v-raf murine sarcoma viral oncogene homolog B1; serine/threonine-protein kinase B-raf; BRAF1; p94; 94 kDa B-raf protein; proto-oncogene B-Raf; murine sarcoma viral (v-raf) oncogene homolog B1; B-Raf proto-oncogene serine/threonine-protein kinase (p94); NS7; RAFB1; B-RAF1; FLJ95109; MGC126806; MGC138284; |
Gene ID | 673 |
mRNA Refseq | NM_004333 |
Protein Refseq | NP_004324 |
MIM | 164757 |
UniProt ID | P15056 |
◆ Recombinant Proteins | ||
Braf-441M | Recombinant Mouse Braf Protein, MYC/DDK-tagged | +Inquiry |
BRAF-182H | Recombinant Human BRAF protein, MYC/DDK-tagged | +Inquiry |
BRAF-0787H | Recombinant Human BRAF Protein (Asn500-His766), N-His tagged | +Inquiry |
BRAF-320H | Recombinant Human BRAF Protein, GST-tagged | +Inquiry |
BRAF-254H | Recombinant Human BRAF protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BRAF-8414HCL | Recombinant Human BRAF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BRAF Products
Required fields are marked with *
My Review for All BRAF Products
Required fields are marked with *
0
Inquiry Basket