Recombinant Human BPNT1 Protein, GST-tagged

Cat.No. : BPNT1-315H
Product Overview : Human BPNT1 full-length ORF ( NP_006076.3, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : BPNT1, also called bisphosphate 3-prime-nucleotidase, or BPntase, is a member of a magnesium-dependent phosphomonoesterase family. Lithium, a major drug used to treat manic depression, acts as an uncompetitive inhibitor of BPntase. The predicted human protein is 92% identical to mouse BPntase. BPntases physiologic role in nucleotide metabolism may be regulated by inositol signaling pathways. The inhibition of human BPntase may account for lithium-induced nephrotoxicity.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 54.5 kDa
AA Sequence : MASSNTVLMRLVASAYSIAQKAGMIVRRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLARKFPKLTIIGEEDLPSEEVDQELIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPLDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYEAGPDAVLGRTIWGVLGLGAFGFQLKEVPAGKHIITTTRSHSNKLVTDCVAAMNPDAVLRVGGAGNKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGAS
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BPNT1 3(2), 5-bisphosphate nucleotidase 1 [ Homo sapiens ]
Official Symbol BPNT1
Synonyms BPNT1; 3(2), 5-bisphosphate nucleotidase 1; 3(2),5-bisphosphate nucleotidase 1; BPntase; PAP-inositol-1,4-phosphatase; bisphosphate 3-nucleotidase 1; PIP;
Gene ID 10380
mRNA Refseq NM_006085
Protein Refseq NP_006076
MIM 604053
UniProt ID O95861

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BPNT1 Products

Required fields are marked with *

My Review for All BPNT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon