Recombinant Human BPIFA3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BPIFA3-5847H
• Product Overview: C20orf71 MS Standard C13 and N15-labeled recombinant protein (NP_001035904) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: BPIFA3 (BPI Fold Containing Family A Member 3) is a Protein Coding gene. Diseases associated with BPIFA3 include Midface Dysplasia and Tympanic Membrane Disease. Gene Ontology (GO) annotations related to this gene include lipid binding. An important paralog of this gene is BPIFB3.
• Molecular Mass: 24.4 kDa
• AA Sequence: MMCPLWRLLIFLGLLALPLAPHKQPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGRKHQQQQESRSFDNNIVKMCAHMSIVVEFWLEKDEFGRRDLVIGKCDAEPSSVHVAILTEAIPPKMNQFLYNLKENLQKVLPHMVESQVCPLIGEILGQLDVKLLKSLIEQEAAHEPTHHETSQPSACQAGESPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BPIFA3 BPI fold containing family A member 3 [ Homo sapiens (human) ]
• Official Symbol: BPIFA3
• Synonyms: BPIFA3; BPI fold containing family A, member 3; C20orf71, chromosome 20 open reading frame 71; BPI fold-containing family A member 3; bA49G10.4; SPLUNC3; short long palate, lung and nasal epithelium carcinoma associated 3; short palate, lung and nasal epithelium carcinoma-associated protein 3; C20orf71; MGC44525
• Gene ID: 128861
• mRNA Refseq: NM_001042439
• Protein Refseq: NP_001035904
• UniProt ID: Q9BQP9