Recombinant Human BPIFA3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : BPIFA3-5847H
Product Overview : C20orf71 MS Standard C13 and N15-labeled recombinant protein (NP_001035904) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : BPIFA3 (BPI Fold Containing Family A Member 3) is a Protein Coding gene. Diseases associated with BPIFA3 include Midface Dysplasia and Tympanic Membrane Disease. Gene Ontology (GO) annotations related to this gene include lipid binding. An important paralog of this gene is BPIFB3.
Molecular Mass : 24.4 kDa
AA Sequence : MMCPLWRLLIFLGLLALPLAPHKQPWPGLAQAHRDNKSTLARIIAQGLIKHNAESRIQNIHFGDRLNASAQVAPGLVGWLISGRKHQQQQESRSFDNNIVKMCAHMSIVVEFWLEKDEFGRRDLVIGKCDAEPSSVHVAILTEAIPPKMNQFLYNLKENLQKVLPHMVESQVCPLIGEILGQLDVKLLKSLIEQEAAHEPTHHETSQPSACQAGESPSTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name BPIFA3 BPI fold containing family A member 3 [ Homo sapiens (human) ]
Official Symbol BPIFA3
Synonyms BPIFA3; BPI fold containing family A, member 3; C20orf71, chromosome 20 open reading frame 71; BPI fold-containing family A member 3; bA49G10.4; SPLUNC3; short long palate, lung and nasal epithelium carcinoma associated 3; short palate, lung and nasal epithelium carcinoma-associated protein 3; C20orf71; MGC44525;
Gene ID 128861
mRNA Refseq NM_001042439
Protein Refseq NP_001035904
UniProt ID Q9BQP9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BPIFA3 Products

Required fields are marked with *

My Review for All BPIFA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon