Recombinant Human BPIFA1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BPIFA1-2084H
• Product Overview: PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_570913) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Product Overview: PLUNC MS Standard C13 and N15-labeled recombinant protein (NP_570913) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
• Description: This gene is the human homolog of murine plunc, and like the mouse gene, is specifically expressed in the upper airways and nasopharyngeal regions. The encoded antimicrobial protein displays antibacterial activity against Gram-negative bacteria. It is thought to be involved in inflammatory responses to irritants in the upper airways and may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer. Multiple transcript variants resulting from alternative splicing in the 3' UTR have been detected, but the full-length nature of only three are known.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 26.7 kDa
• AA Sequence: MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BPIFA1 BPI fold containing family A member 1 [ Homo sapiens (human) ]
• Official Symbol: BPIFA1
• Synonyms: BPIFA1; BPI fold containing family A, member 1; LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5; BPI fold-containing family A member 1; protein Plunc; von Ebner protein Hl; lung-specific protein X; ligand-binding protein RYA3; tracheal epithelium enriched protein; tracheal epithelium-enriched protein; nasopharyngeal carcinoma-related protein; palate, lung and nasal epithelium associated; secretory protein in upper respiratory tracts; palate lung and nasal epithelium clone protein; UNQ787/PRO1606
• Gene ID: 51297
• mRNA Refseq: NM_130852
• Protein Refseq: NP_570913
• MIM: 607412
• UniProt ID: Q9NP55