Recombinant Human BPIFA1 protein, His-SUMO-tagged

• Cat.No.: BPIFA1-2463H
• Product Overview: Recombinant Human BPIFA1 protein(Q9NP55)(20-256aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Product Overview: Recombinant Human BPIFA1 protein(Q9NP55)(20-256aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.
• Source: E. coli
• Species: Human
• Tag: His&SUMO
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 40.7 kDa
• Protein length: 20-256aa
• AA Sequence: QFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: BPIFA1 BPI fold containing family A, member 1 [ Homo sapiens ]
• Official Symbol: BPIFA1
• Synonyms: BPIFA1; BPI fold containing family A, member 1; LUNX; NASG; PLUNC; SPURT; SPLUNC1; bA49G10.5; BPI fold-containing family A member 1; protein Plunc; von Ebner protein Hl; lung-specific protein X; ligand-binding protein RYA3; tracheal epithelium enriched protein; tracheal epithelium-enriched protein; nasopharyngeal carcinoma-related protein; palate, lung and nasal epithelium associated; secretory protein in upper respiratory tracts; palate lung and nasal epithelium clone protein; UNQ787/PRO1606
• Gene ID: 51297
• mRNA Refseq: NM_130852
• Protein Refseq: NP_057667
• MIM: 607412
• UniProt ID: Q9NP55