Recombinant Human BPHL protein, His-SUMO-tagged

• Cat.No.: BPHL-4596H
• Product Overview: Recombinant Human BPHL protein(Q86WA6)(1-274aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-274aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.1 kDa
• AA Sequence: MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: BPHL biphenyl hydrolase-like (serine hydrolase) [ Homo sapiens ]
• Official Symbol: BPHL
• Synonyms: BPHL; biphenyl hydrolase-like (serine hydrolase); MCNAA; valacyclovir hydrolase; Bph rp; breast epithelial mucin associated antigen; valacyclovirase; biphenyl hydrolase-like protein; biphenyl hydrolase-related protein; breast epithelial mucin-associated antigen; BPH-RP; VACVASE; MGC41865; MGC125930
• Gene ID: 670
• mRNA Refseq: NM_004332
• Protein Refseq: NP_004323
• MIM: 603156
• UniProt ID: Q86WA6