Recombinant Human BORCS8 Protein, GST-tagged

• Cat.No.: BORCS8-4457H
• Product Overview: Human MEF2BNB full-length ORF (AAH04449.1, 1 a.a. - 109 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: BORCS8 (BLOC-1 Related Complex Subunit 8) is a Protein Coding gene. Among its related pathways are P38 MAPK Signaling Pathway (sino).
• Molecular Mass: 37.73 kDa
• AA Sequence: MEEPEMQLKGKKVTDKFTESVYVLANEPSVALYRLQEHVRRSLPELAQHKADMQRWEEQSQGAIYTVEYACSAVKNLVDSSVHFRSVEGLLKQAISIRDHMNASAQGHR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BORCS8 BLOC-1 related complex subunit 8 [ Homo sapiens (human) ]
• Official Symbol: BORCS8
• Synonyms: MEF2BNB; MEF2B neighbor; protein MEF2BNB; MEF2B neighbor gene protein; AK128256; FLJ32599; FLJ46391; MGC189732; MGC189763; BORCS8; BLOC-1 related complex subunit 8
• Gene ID: 729991
• mRNA Refseq: NM_001145783
• Protein Refseq: NP_001139255
• UniProt ID: Q96FH0