Recombinant Human Bone Morphogenetic Protein 7

• Cat.No.: BMP7-12H
• Product Overview: Recombinant Human Bone Morphogenetic Protein 7 Gene encoding the human Bone Morphogenetic Protein 7 protein sequence (containing the signal peptide sequence, and the mature BMP7 sequence) was expressed in modifiedhuman 293 cells.

Specification

• Cat. No.: BMP7-12H
• Description: Bone morphogenetic proteins (BMPs) are a group of approximately 15 structurally related proteins belonging to the TGF-beta protein family. One member of this family is bone morphogenetic protein 7 (BMP-7). BMP-7 is a 431 amino acid protein that exists as a homodimer, linked by a single disulfide bond. BMP-7 is expressed in a wide variety of tissues including bone marrow, spleen, thymus, heart, muscle, liver, kidney pancreas, prostate and lung, in embryonic tissues, as well as in the central nervous system (including spinal cord).
• Source: Human 293 cells.
• Amino Acid Sequence: STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAP EGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSS NVILKKYRNMVVRACGCH.
• Molecular Mass: Bone Morphogenetic Protein 7 migrates as a broad band between 15 and 16 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with unmodified BMP-7 that has a predicted molecular mass of 15.7 kDa.
• pI: The unmodified BMP-7 has a predicted pI of 8.5.
• Glycosylation: Bone Morphogenetic Protein 7 contains N-linked and possibly O-linked oligosaccharides.
• Purity: >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue.
• Formulation: When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.
• Reconstitution: It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.
• Storage: Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, with longer-term storage inaliquots at -18 to -20°C. Repeated freeze thawing is not recommended.
• Tag: Non

Gene Information

• Gene Name: BMP7 bone morphogenetic protein 7 [ Homo sapiens ]
• Synonyms: BMP7; bone morphogenetic protein 7; OP-1; osteogenic protein 1; Eptotermin alfa; BMP-7
• Gene ID: 655
• mRNA Refseq: NM_001719
• Protein Refseq: NP_001710
• UniProt ID: P18075
• Chromosome Location: 20q13
• MIM: 112267
• Pathway: Cytokine-cytokine receptor interaction; Hedgehog signaling pathway; TGF-beta signaling pathway
• Function: cytokine activity; growth factor activity; parin binding; protein binding