Recombinant Human BOLL Protein, GST-tagged
Cat.No. : | BOLL-305H |
Product Overview : | Human BOLL full-length ORF (BAB71664.1, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the DAZ gene family required for germ cell development. It encodes an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 57.7 kDa |
AA Sequence : | MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BOLL bol, boule-like (Drosophila) [ Homo sapiens ] |
Official Symbol | BOLL |
Synonyms | BOLL; bol, boule-like (Drosophila); bol (Drosophila boule homolog) like; protein boule-like; BOULE; |
Gene ID | 66037 |
mRNA Refseq | NM_033030 |
Protein Refseq | NP_149019 |
MIM | 606165 |
UniProt ID | Q8N9W6 |
◆ Recombinant Proteins | ||
BOLL-10269H | Recombinant Human BOLL, GST-tagged | +Inquiry |
BOLL-383R | Recombinant Rhesus Macaque BOLL Protein, His (Fc)-Avi-tagged | +Inquiry |
BOLL-305H | Recombinant Human BOLL Protein, GST-tagged | +Inquiry |
BOLL-555R | Recombinant Rhesus monkey BOLL Protein, His-tagged | +Inquiry |
BOLL-3767HF | Recombinant Full Length Human BOLL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BOLL-8419HCL | Recombinant Human BOLL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BOLL Products
Required fields are marked with *
My Review for All BOLL Products
Required fields are marked with *
0
Inquiry Basket