Recombinant Human BOLA3 Protein, GST-tagged

Cat.No. : BOLA3-304H
Product Overview : Human BOLA3 full-length ORF ( AAH42036.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 33.8 kDa
AA Sequence : MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIE
Quality Control Test : 12.5% SDS-PAGE Stained with Coomassie Blue.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BOLA3 bolA homolog 3 (E. coli) [ Homo sapiens ]
Official Symbol BOLA3
Synonyms bolA homolog 3 (E. coli); bolA-like 3 (E. coli); MMDS2; bolA-like protein 3; BOLA3
Gene ID 388962
mRNA Refseq NM_212552.2
Protein Refseq NP_997717.2
MIM 613183
UniProt ID Q53S33

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BOLA3 Products

Required fields are marked with *

My Review for All BOLA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon