Recombinant Human BOC Protein

• Cat.No.: BOC-296H
• Product Overview: Human BOC full-length ORF (ADZ15974.1) recombinant protein without tag.

Specification

• Description: CDON (MIM 608707) and BOC are cell surface receptors of the immunoglobulin (Ig)/fibronectin type III (FNIII; see MIM 135600) repeat family involved in myogenic differentiation. CDON and BOC are coexpressed during development, form complexes with each other in a cis fashion, and are related to each other in their ectodomains, but each has a unique long cytoplasmic tail.
• Source: Wheat Germ
• Species: Human
• Form: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Molecular Mass: 17.3 kDa
• AA Sequence: MLRGTMTAWRGMRPEVTLACLLLATAGCFADLNEVPQVTVQPASTVQKPGGTVILGCVVEPPRMNVTWRLNGKELNGSDDALGVLITHGTLVITALNNHTVGRYQCVARMPAGAVASVPATVTLASESAPLPPCHGAVPPHLSHPEAPTIHAASCYS
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
• Tag: Non

Gene Information

• Gene Name: BOC Boc homolog (mouse) [ Homo sapiens ]
• Official Symbol: BOC
• Synonyms: BOC
• Gene ID: 91653
• mRNA Refseq: NM_033254.2
• Protein Refseq: NP_150279.1
• MIM: 608708
• UniProt ID: Q9BWV1