Recombinant Human BNP Protein
Cat.No. : | BNP-08H |
Product Overview : | Recombinant Human BNP Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 32 amino acids |
Description : | Natriuretic Peptide Precursor B acts as a cardiac hormone with a variety of biological actions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. It is thought to play a key role in cardiovascular homeostasis. Helps restore the body's salt and water balance. Improves heart function. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Data Not Available. |
Molecular Mass : | 3464 Da, a single non-glycosylated polypeptide chain containing 32 amino acids. |
AA Sequence : | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Endotoxin : | Less than 1 EU/μg of rHuCNTF as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 or -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Official Symbol | BNP |
Synonyms | Brain Natriuretic Peptide; BNP |
◆ Recombinant Proteins | ||
BNP-71H | Recombinant Human BNP | +Inquiry |
BNP-08H | Recombinant Human BNP Protein | +Inquiry |
◆ Native Proteins | ||
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BNP Products
Required fields are marked with *
My Review for All BNP Products
Required fields are marked with *
0
Inquiry Basket