Recombinant Human BNIP3L

• Cat.No.: BNIP3L-26756TH
• Product Overview: Recombinant fragment corresponding to amino acids 43-130 of Human BNIP3L with an N terminal proprietary tag; Predicted MWt 35.31 kDa.

Specification

• Description: This gene is a member of the BCL2/adenovirus E1B 19 kd-interacting protein (BNIP) family. It interacts with the E1B 19 kDa protein, which protects cells from virally-induced cell death. The encoded protein also interacts with E1B 19 kDa-like sequences of BCL2, another apoptotic protector. This protein counteracts the apoptotic inducer BNIP3 and may play a role in tumor suppression.
• Protein length: 88 amino acids
• Molecular Weight: 35.310kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SSNGNDNGNGKNGGLEHVPSSSSIHNGDMEKILLDAQHESGQSSSRGSSHCDSPSPQEDGQIMFDVEMHTSRDHSSQSEEEVVEGEKE
• Sequence Similarities: Belongs to the NIP3 family.
• Tag: Non

Gene Information

• Gene Name: BNIP3L BCL2/adenovirus E1B 19kDa interacting protein 3-like [ Homo sapiens ]
• Official Symbol: BNIP3L
• Synonyms: BNIP3L; BCL2/adenovirus E1B 19kDa interacting protein 3-like; BCL2/adenovirus E1B 19kD interacting protein 3 like; BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like; BNIP3a; Nix
• Gene ID: 665
• mRNA Refseq: NM_004331
• Protein Refseq: NP_004322
• MIM: 605368
• Uniprot ID: O60238
• Chromosome Location: 8p21
• Pathway: Apoptosis, organism-specific biosystem; Direct p53 effectors, organism-specific biosystem
• Function: identical protein binding; lamin binding; lamin binding; protein binding; protein heterodimerization activity