Recombinant Human BMPR1A Protein (177-532 aa), His-SUMO-tagged
Cat.No. : | BMPR1A-361H |
Product Overview : | Recombinant Human BMPR1A Protein (177-532 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 177-532 aa |
Description : | On ligand binding, forms a receptor complex consisting of two type II and two type I transmbrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for BMP-2 and BMP-4. Positively regulates chondrocyte differentiation through GDF5 interaction. |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 56.6 kDa |
AA Sequence : | KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | BMPR1A bone morphogenetic protein receptor, type IA [ Homo sapiens ] |
Official Symbol | BMPR1A |
Synonyms | BMPR1A; ACVRLK3; ALK3; CD292; ALK-3; BMPR-1A; SKR5; 10q23del; |
Gene ID | 657 |
mRNA Refseq | NM_004329 |
Protein Refseq | NP_004320 |
MIM | 601299 |
UniProt ID | P36894 |
◆ Recombinant Proteins | ||
BMPR1A-281H | Recombinant Human BMPR1A Protein, GST-tagged | +Inquiry |
BMPR1A-361H | Recombinant Human BMPR1A Protein (177-532 aa), His-SUMO-tagged | +Inquiry |
BMPR1A-0788H | Recombinant Human BMPR1A Protein (M1-I532), GST tagged | +Inquiry |
BMPR1A-142H | Recombinant Human BMPR1A protein, hIgG/His-tagged | +Inquiry |
BMPR1A-0684H | Recombinant Human BMPR1A Protein (Gln24-Arg152), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMPR1A-2466MCL | Recombinant Mouse BMPR1A cell lysate | +Inquiry |
BMPR1A-2145HCL | Recombinant Human BMPR1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMPR1A Products
Required fields are marked with *
My Review for All BMPR1A Products
Required fields are marked with *
0
Inquiry Basket