Description :	Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body, and are involved in diverse physiological processes during both pre- and postnatal life.
Source :	E. coli
Species :	Human
Molecular Mass :	24.2 kDa
AA Sequence :	MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Purity :	≥ 98% by SDS-PAGE gel and HPLC analyses.
Protein length :	303-408 a.a.
Full Length :	Full L.

Gene Name	BMP4 bone morphogenetic protein 4 [ Homo sapiens (human) ]
Official Symbol	BMP4
Synonyms	BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6;
Gene ID	652
mRNA Refseq	NM_001202
Protein Refseq	NP_001193
MIM	112262
UniProt ID	P12644

BMP2-123H	GMP Recombinant Human BMP2	+Inquiry
IFNA1-86H	Active GMP Recombinant Human IFNA1 protein	+Inquiry
IL1A-4315HG	GMP Recombinant Human IL1A protein	+Inquiry
IL1B-4316HG	GMP Recombinant Human IL1B protein	+Inquiry
IL2-4317HG	GMP Recombinant Human IL2 protein	+Inquiry

COA

Required fields are marked with *

Required fields are marked with *

Overall Rating *

Cat NO.

Review

Your Name

Phone Number

E-mail Address

Cat.No. :	BMP4-26HG
Product Overview :	GMP Recombinant Human BMP4 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. E.coli-derived Human BMP-4 is a fully active homodimeric protein consisting of two 107 amino acid subunits, which correspond to amino acids 303-408 of the full length BMP-4 precursor, as well as an N-terminal Methionine.

Recombinant Human BMP4 Protein, GMP Grade, Animal-Free