Recombinant Human BMP4 Protein, GMP Grade, Animal-Free

• Cat.No.: BMP4-26HG
• Product Overview: GMP Recombinant Human BMP4 protein with out tag was expressed in E. coli and manufactured using animal-derived component free materials. E.coli-derived Human BMP-4 is a fully active homodimeric protein consisting of two 107 amino acid subunits, which correspond to amino acids 303-408 of the full length BMP-4 precursor, as well as an N-terminal Methionine.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 303-408 a.a.
• Description: Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-β superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body, and are involved in diverse physiological processes during both pre- and postnatal life.
• Molecular Mass: 24.2 kDa
• AA Sequence: MKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
• Purity: ≥ 98% by SDS-PAGE gel and HPLC analyses.
• Full Length: Full L.

Gene Information

• Gene Name: BMP4 bone morphogenetic protein 4 [ Homo sapiens (human) ]
• Official Symbol: BMP4
• Synonyms: BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6
• Gene ID: 652
• mRNA Refseq: NM_001202
• Protein Refseq: NP_001193
• MIM: 112262
• UniProt ID: P12644