Recombinant Human BMP4 protein
Cat.No. : | BMP4-261H |
Product Overview : | Recombinant Human BMP4, transcript variant 1, was expressed in HeLa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HeLa |
Tag : | Non |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Molecular Mass : | 46.4 |
AA Sequence : | HHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | BMP4 bone morphogenetic protein 4 [ Homo sapiens ] |
Official Symbol | BMP4 |
Synonyms | BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6; |
Gene ID | 652 |
mRNA Refseq | NM_001202 |
Protein Refseq | NP_001193 |
MIM | 112262 |
UniProt ID | P12644 |
◆ Recombinant Proteins | ||
BMP4-001H | Recombinant Human BMP4 Protein, His-MBP-tagged | +Inquiry |
Bmp4-578TM | Recombinant Murine BMP4 | +Inquiry |
BMP4-21H | Recombinant Human BMP4, His-tagged | +Inquiry |
BMP4-568C | Recombinant Chicken BMP4 protein, His-tagged | +Inquiry |
BMP4-26170TH | Recombinant Human BMP4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
0
Inquiry Basket