Recombinant Human BMP4 Protein
Cat.No. : | BMP4-402H |
Product Overview : | Recombinant Human BMP4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | Bone Morphogenetic Protein 4 is one of the BMPs, some of which belong to the TGF-beta superfamily (BMP2-7). There are more than thirteen BMPs have been discovered nowadays and they are involved in inducing cartilage and bone formation. BMP-4 is expressed in the lung and lower levels seen in the kidney. It also presents in normal and neoplastic prostate tissues, and prostate cancer cell lines. It regulates the formation of teeth, limbs and bone from mesoderm. Furthermore it also plays a role in fracture repair. BMP-4 signals through tetrameric complexes composed of type I and type II receptors and regulates it function by interaction with multiple proteins and glycosaminoglycans. The human BMP-4 shares 98 % sequence indentity with mouse BMP-4. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. |
Form : | Sterile Filtered White lyophil |
Molecular Mass : | Approximately 13.3 kDa |
AA Sequence : | MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Endotoxin : | Less than 1 EU/μg of rHuBMP-4 as determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2 μm filtered concentrated solution in 50 mM Na2CO3, 5 mM DTT, pH 11.0. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.1-1.0 mg/mL. |
Gene Name | BMP4 bone morphogenetic protein 4 [ Homo sapiens (human) ] |
Official Symbol | BMP4 |
Synonyms | BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6; |
Gene ID | 652 |
mRNA Refseq | NM_001202 |
Protein Refseq | NP_001193 |
MIM | 112262 |
UniProt ID | P12644 |
◆ Recombinant Proteins | ||
BMP4-6790C | Recombinant Chicken BMP4 | +Inquiry |
BMP4-2432M | Recombinant Mouse BMP4 Protein | +Inquiry |
BMP4-571P | Recombinant Pig BMP4 protein, His & GST-tagged | +Inquiry |
Bmp4-214M | Recombinant Mouse Bmp4 protein, His/S-tagged | +Inquiry |
BMP4-23H | Recombinant Human Bone Morphogenetic Protein 4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
0
Inquiry Basket