Recombinant Human BMP4 Protein

Cat.No. : BMP4-03H
Product Overview : Recombinant BMP-4 (293-408 aa) protein without tag was expressed as insoluble protein aggregate in E. coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 117 aa
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers.
Form : Liquid
Molecular Mass : 13.2 kDa
AA Sequence : MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 85% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 10 mM Sodium Citrate buffer (pH 3.5) containing 10% glycerol
Gene Name BMP4 bone morphogenetic protein 4 [ Homo sapiens (human) ]
Official Symbol BMP4
Synonyms BMP4; bone morphogenetic protein 4; ZYME; BMP2B; OFC11; BMP2B1; MCOPS6; bone morphogenetic protein 4; bone morphogenetic protein 2B
Gene ID 652
mRNA Refseq NM_001202
Protein Refseq NP_001193
MIM 112262
UniProt ID P12644

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BMP4 Products

Required fields are marked with *

My Review for All BMP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon