Recombinant Human BMP4 protein
Cat.No. : | BMP4-02H |
Product Overview : | Recombinant Human BMP4 protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 117 |
Description : | Bone Morphogenetic Protein 4 is one of the BMPs, some of which belong to the TGF-beta superfamily (BMP2-7). There are more than thirteen BMPs have been discovered nowadays and they are involved in inducing cartilage and bone formation. BMP-4 is expressed in the lung and lower levels seen in the kidney. It also presents in normal and neoplastic prostate tissues, and prostate cancer cell lines. It regulates the formation of teeth, limbs and bone from mesoderm. Furthermore it also plays a role in fracture repair. BMP-4 signals through tetrameric complexes composed of type I and type II receptors and regulates it function by interaction with multiple proteins and glycosaminoglycans. The human BMP-4 shares 98 % sequence indentity with mouse BMP-4. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in 50 mM Na2CO3, 5 mM DTT, pH 11.0. |
Molecular Mass : | Approximately 13.3 kDa, a monomeric, non-glycosylated polypeptide chain containing 117 amino acids. |
AA Sequence : | MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR |
Endotoxin : | Less than 1 EU/µg of rHuBMP-4 as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analysis. |
Applications : | Molecular standard (Western, ELISA) in studying secreted BMP-4; Preparing antibodies for BMP-4 monomer; Molecule standard in detecting secreted BMP-4 in reduced SDS-PAGE. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | BMP4 |
Official Symbol | BMP4 |
Synonyms | BMP4; bone morphogenetic protein 4; BMP2B; BMP-4; BMP-2B; bone morphogenetic protein 2B; ZYME; OFC11; BMP2B1; MCOPS6; |
Gene ID | 652 |
mRNA Refseq | NM_001202 |
Protein Refseq | NP_001193 |
MIM | 112262 |
UniProt ID | P12644 |
◆ Recombinant Proteins | ||
BMP4-213H | Recombinant Human BMP4 protein, His/S-tagged | +Inquiry |
BMP4-0772H | Recombinant Human BMP4 Protein (Ala24-Arg408), N-His tagged | +Inquiry |
BMP4-402H | Recombinant Human BMP4 Protein | +Inquiry |
BMP4-21H | Recombinant Human BMP4, His-tagged | +Inquiry |
Bmp4-324M | Recombinant Mouse Bmp4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP4-8431HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
BMP4-8432HCL | Recombinant Human BMP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP4 Products
Required fields are marked with *
My Review for All BMP4 Products
Required fields are marked with *
0
Inquiry Basket