Recombinant Human BMP2K Protein, GST-tagged

Description :	This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Form :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass :	37.84 kDa
AA Sequence :	YQQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRS
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	BMP2K BMP2 inducible kinase [ Homo sapiens ]
Official Symbol	BMP2K
Synonyms	BMP2K; BMP2 inducible kinase; BMP-2-inducible protein kinase; BIKe; DKFZp434K0614; BIKE; HRIHFB2017; DKFZp434P0116;
Gene ID	55589
mRNA Refseq	NM_017593
Protein Refseq	NP_060063
UniProt ID	Q9NSY1