Recombinant Human BMP1 protein, GST-tagged
Cat.No. : | BMP1-26314TH |
Product Overview : | Recombinant Human BMP1(747 a.a. - 845 a.a.) fused with GST tag at N-terminal was expressed in Wheat germ. |
Availability | April 24, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 747-845 a.a. |
Description : | This gene encodes a protein that is capable of inducing formation of cartilage in vivo. Although other bone morphogenetic proteins are members of the TGF-beta superfamily, this gene encodes a protein that is not closely related to other known growth factors. This gene is expressed as alternatively spliced variants that share an N-terminal protease domain but differ in their C-terminal region. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.63 kDa |
AA Sequence : | CDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRF CGSKKPEPVLATGSRMFLRFYSDN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | BMP1 bone morphogenetic protein 1 [ Homo sapiens ] |
Official Symbol | BMP1 |
Synonyms | BMP1; bone morphogenetic protein 1; PCOLC, procollagen C endopeptidase; procollagen C endopeptidase; procollagen C-proteinase; mammalian tolloid protein; procollagen C-endopeptidase; PCP; TLD; PCP2; PCOLC; FLJ44432; |
Gene ID | 649 |
mRNA Refseq | NM_006129 |
Protein Refseq | NP_006120 |
MIM | 112264 |
UniProt ID | P13497 |
Chromosome Location | 8p21 |
Pathway | Adipogenesis, organism-specific biosystem; HDL-mediated lipid transport, organism-specific biosystem; Lipid digestion, mobilization, and transport, organism-specific biosystem; Lipoprotein metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; |
Function | calcium ion binding; cytokine activity; growth factor activity; metal ion binding; metalloendopeptidase activity; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; peptidase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
BMP1-1050M | Recombinant Mouse BMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMP1-2428M | Recombinant Mouse BMP1 Protein | +Inquiry |
BMP1-256H | Recombinant Human BMP1 Protein, GST-tagged | +Inquiry |
Bmp1-663M | Recombinant Mouse Bmp1 protein, His-tagged | +Inquiry |
BMP1-374R | Recombinant Rhesus Macaque BMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP1-8436HCL | Recombinant Human BMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP1 Products
Required fields are marked with *
My Review for All BMP1 Products
Required fields are marked with *
0
Inquiry Basket