Recombinant Human BMP1 protein, GST-tagged
Cat.No. : | BMP1-30198H |
Product Overview : | Recombinant Human BMP1 (58-140 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Leu1-Gly140 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | LDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | BMP1 bone morphogenetic protein 1 [ Homo sapiens ] |
Official Symbol | BMP1 |
Synonyms | BMP1; bone morphogenetic protein 1; PCOLC, procollagen C endopeptidase; procollagen C endopeptidase; procollagen C-proteinase; mammalian tolloid protein; procollagen C-endopeptidase; PCP; TLD; PCP2; PCOLC; FLJ44432; |
Gene ID | 649 |
mRNA Refseq | NM_001199 |
Protein Refseq | NP_001190 |
MIM | 112264 |
UniProt ID | P13497 |
◆ Recombinant Proteins | ||
BMP1-256H | Recombinant Human BMP1 Protein, GST-tagged | +Inquiry |
BMP1-26314TH | Recombinant Human BMP1 protein, GST-tagged | +Inquiry |
BMP1-2548H | Recombinant Human BMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
BMP1-2428M | Recombinant Mouse BMP1 Protein | +Inquiry |
BMP1-1050M | Recombinant Mouse BMP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP1-8436HCL | Recombinant Human BMP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP1 Products
Required fields are marked with *
My Review for All BMP1 Products
Required fields are marked with *
0
Inquiry Basket