Recombinant Human BMP1 protein, GST-tagged

Cat.No. : BMP1-30198H
Product Overview : Recombinant Human BMP1 (58-140 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Leu1-Gly140
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : LDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIG
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name BMP1 bone morphogenetic protein 1 [ Homo sapiens ]
Official Symbol BMP1
Synonyms BMP1; bone morphogenetic protein 1; PCOLC, procollagen C endopeptidase; procollagen C endopeptidase; procollagen C-proteinase; mammalian tolloid protein; procollagen C-endopeptidase; PCP; TLD; PCP2; PCOLC; FLJ44432;
Gene ID 649
mRNA Refseq NM_001199
Protein Refseq NP_001190
MIM 112264
UniProt ID P13497

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BMP1 Products

Required fields are marked with *

My Review for All BMP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon