Recombinant Human BLZF1 Protein, GST-tagged

Cat.No. : BLZF1-253H
Product Overview : Human BLZF1 partial ORF ( NP_003657, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : KLAKAVNSHLLGNVGINNQKKIPSTVEFCSTPAEKMAETVLRILDPVTCKESSPDNPFFESSPTTLLATKKNIGRFHPYTRYENITFNCCNHCRGELIAL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BLZF1 basic leucine zipper nuclear factor 1 [ Homo sapiens ]
Official Symbol BLZF1
Synonyms BLZF1; basic leucine zipper nuclear factor 1; Golgin-45; JEM 1; JEM-1short protein; cytoplasmic protein; p45 basic leucine-zipper nuclear factor; JEM1; JEM-1; JEM-1s; GOLGIN-45; MGC22497;
Gene ID 8548
mRNA Refseq NM_003666
Protein Refseq NP_003657
MIM 608692
UniProt ID Q9H2G9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BLZF1 Products

Required fields are marked with *

My Review for All BLZF1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon