Recombinant Human BLMH Protein, GST-tagged

• Cat.No.: BLMH-243H
• Product Overview: Human BLMH partial ORF ( NP_000377, 356 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.63 kDa
• AA Sequence: NMNKAERLTFGESLMTHAMTFTAVSEKDDQDGAFTKWRVENSWGEDHGHKGYLCMTDEWFSEYVYEVVVDRKHVPEEVLAVLEQEPIILPAWDPMGALA
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BLMH bleomycin hydrolase [ Homo sapiens ]
• Official Symbol: BLMH
• Synonyms: BLMH; bleomycin hydrolase; BH; BLM hydrolase; BMH
• Gene ID: 642
• mRNA Refseq: NM_000386
• Protein Refseq: NP_000377
• MIM: 602403
• UniProt ID: Q13867