Recombinant Human BIRC5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: BIRC5-5592H
• Product Overview: BIRC5/Survivin MS Standard C13 and N15-labeled recombinant protein (NP_001159) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene is a member of the inhibitor of apoptosis (IAP) gene family, which encode negative regulatory proteins that prevent apoptotic cell death. IAP family members usually contain multiple baculovirus IAP repeat (BIR) domains, but this gene encodes proteins with only a single BIR domain. The encoded proteins also lack a C-terminus RING finger domain. Gene expression is high during fetal development and in most tumors, yet low in adult tissues. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 16.2 kDa
• AA Sequence: MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFCFKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNKKKEFEETAKKVRRAIEQLAAMDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: BIRC5 baculoviral IAP repeat containing 5 [ Homo sapiens (human) ]
• Official Symbol: BIRC5
• Synonyms: BIRC5; baculoviral IAP repeat containing 5; API4, apoptosis inhibitor 4, baculoviral IAP repeat containing 5; baculoviral IAP repeat-containing protein 5; EPR 1; survivin; survivin variant 3 alpha; apoptosis inhibitor 4; apoptosis inhibitor survivin; API4; EPR-1
• Gene ID: 332
• mRNA Refseq: NM_001168
• Protein Refseq: NP_001159
• MIM: 603352
• UniProt ID: O15392