Recombinant Human BHMT2 Protein, GST-tagged
Cat.No. : | BHMT2-216H |
Product Overview : | Human BHMT2 partial ORF ( NP_060084, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Homocysteine is a sulfur-containing amino acid that plays a crucial role in methylation reactions. Transfer of the methyl group from betaine to homocysteine creates methionine, which donates the methyl group to methylate DNA, proteins, lipids, and other intracellular metabolites. The protein encoded by this gene is one of two methyl transferases that can catalyze the transfer of the methyl group from betaine to homocysteine. Anomalies in homocysteine metabolism have been implicated in disorders ranging from vascular disease to neural tube birth defects such as spina bifida. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | MAPAGRPGAKKGILERLESGEVVIGDGSFLITLEKRGYVKAGLWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVA |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BHMT2 betaine--homocysteine S-methyltransferase 2 [ Homo sapiens ] |
Official Symbol | BHMT2 |
Synonyms | BHMT2; betaine--homocysteine S-methyltransferase 2; S-methylmethionine--homocysteine S-methyltransferase BHMT2; SMM-hcy methyltransferase; betaine-homocysteine methyltransferase 2; FLJ20001; |
Gene ID | 23743 |
mRNA Refseq | NM_001178005 |
Protein Refseq | NP_001171476 |
MIM | 605932 |
UniProt ID | Q9H2M3 |
◆ Recombinant Proteins | ||
BHMT2-216H | Recombinant Human BHMT2 Protein, GST-tagged | +Inquiry |
BHMT2-346H | Recombinant Human BHMT2 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
BHMT2-1030M | Recombinant Mouse BHMT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BHMT2-10224H | Recombinant Human BHMT2, His-tagged | +Inquiry |
BHMT2-2400M | Recombinant Mouse BHMT2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BHMT2-8457HCL | Recombinant Human BHMT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BHMT2 Products
Required fields are marked with *
My Review for All BHMT2 Products
Required fields are marked with *
0
Inquiry Basket