Recombinant Human BHMT2 Protein, GST-tagged

Cat.No. : BHMT2-216H
Product Overview : Human BHMT2 partial ORF ( NP_060084, 1 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Homocysteine is a sulfur-containing amino acid that plays a crucial role in methylation reactions. Transfer of the methyl group from betaine to homocysteine creates methionine, which donates the methyl group to methylate DNA, proteins, lipids, and other intracellular metabolites. The protein encoded by this gene is one of two methyl transferases that can catalyze the transfer of the methyl group from betaine to homocysteine. Anomalies in homocysteine metabolism have been implicated in disorders ranging from vascular disease to neural tube birth defects such as spina bifida.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 37.84 kDa
AA Sequence : MAPAGRPGAKKGILERLESGEVVIGDGSFLITLEKRGYVKAGLWTPEAVIEHPDAVRQLHMEFLRAGSNVMQTFTFSASEDNMESKWEDVNAAACDLAREVAGKGDALVA
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BHMT2 betaine--homocysteine S-methyltransferase 2 [ Homo sapiens ]
Official Symbol BHMT2
Synonyms BHMT2; betaine--homocysteine S-methyltransferase 2; S-methylmethionine--homocysteine S-methyltransferase BHMT2; SMM-hcy methyltransferase; betaine-homocysteine methyltransferase 2; FLJ20001;
Gene ID 23743
mRNA Refseq NM_001178005
Protein Refseq NP_001171476
MIM 605932
UniProt ID Q9H2M3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BHMT2 Products

Required fields are marked with *

My Review for All BHMT2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon