Recombinant Human BHLHE41 Protein, GST-tagged

• Cat.No.: BHLHE41-208H
• Product Overview: Human BHLHB3 partial ORF ( NP_110389, 203 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Source: Wheat Germ
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 34.54 kDa
• AA Sequence: CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BHLHE41 basic helix-loop-helix family, member e41 [ Homo sapiens ]
• Official Symbol: BHLHE41
• Synonyms: BHLHE41; basic helix-loop-helix family, member e41; basic helix loop helix domain containing, class B, 3 , BHLHB3; class E basic helix-loop-helix protein 41; bHLHe41; DEC2; differentially expressed in chondrocytes 2; Enhancer of split and hairy related protein 1; SHARP 1; SHARP1; enhancer-of-split and hairy-related protein 1; differentially expressed in chondrocytes protein 2; basic helix-loop-helix domain containing, class B, 3; hDEC2; BHLHB3
• Gene ID: 79365
• mRNA Refseq: NM_030762
• Protein Refseq: NP_110389
• MIM: 606200
• UniProt ID: Q9C0J9