Recombinant Human BHLHE41 Protein, GST-tagged

Cat.No. : BHLHE41-208H
Product Overview : Human BHLHB3 partial ORF ( NP_110389, 203 a.a. - 282 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 34.54 kDa
AA Sequence : CLERAGQKLEPLAYCVPVIQRTQPSAELAAENDTDTDSGYGGEAEARPDREKGKGAGASRVTIKQEPPGEDSPAPKRMKL
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BHLHE41 basic helix-loop-helix family, member e41 [ Homo sapiens ]
Official Symbol BHLHE41
Synonyms BHLHE41; basic helix-loop-helix family, member e41; basic helix loop helix domain containing, class B, 3 , BHLHB3; class E basic helix-loop-helix protein 41; bHLHe41; DEC2; differentially expressed in chondrocytes 2; Enhancer of split and hairy related protein 1; SHARP 1; SHARP1; enhancer-of-split and hairy-related protein 1; differentially expressed in chondrocytes protein 2; basic helix-loop-helix domain containing, class B, 3; hDEC2; BHLHB3;
Gene ID 79365
mRNA Refseq NM_030762
Protein Refseq NP_110389
MIM 606200
UniProt ID Q9C0J9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BHLHE41 Products

Required fields are marked with *

My Review for All BHLHE41 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon