Recombinant Human BHLHE22 protein, His-tagged

• Cat.No.: BHLHE22-3611H
• Product Overview: Recombinant Human BHLHE22 protein(1-225 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• Protein length: 1-225 aa
• AA Sequence: MERGMHLGAAAAGEDDLFLHKSLSASTSKRLEAAFRSTPPGMDLSLAPPPRERPASSSSSPLGCFEPADPEGAGLLLPPPGGGGGGSAGSGGGGGGGVGVPGLLVGSAGVGGDPSLSSLPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPRASPGAGGGGAKAAEGCSNAHLHGGASVPPGGLGGGGGGGSSSGSSGGGGGSGSGSGG
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: BHLHE22 basic helix-loop-helix family, member e22 [ Homo sapiens ]
• Official Symbol: BHLHE22
• Synonyms: BHLHE22; basic helix-loop-helix family, member e22; basic helix loop helix domain containing, class B, 5 , BHLHB5, TNRC20, trinucleotide repeat containing 20; class E basic helix-loop-helix protein 22; Beta3; bHLHe22; CAGL85; trinucleotide repeat containing 20; class B basic helix-loop-helix protein 5; trinucleotide repeat-containing gene 20 protein; basic helix-loop-helix domain containing, class B, 5; BHLHB5; TNRC20
• Gene ID: 27319
• mRNA Refseq: NM_152414
• Protein Refseq: NP_689627
• MIM: 613483
• UniProt ID: Q8NFJ8