Recombinant Human BGN protein, His-SUMO & Myc-tagged

• Cat.No.: BGN-2590H
• Product Overview: Recombinant Human BGN protein(P21810)(38-368aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 38-368aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 57.2 kDa
• AA Sequence: DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: BGN biglycan [ Homo sapiens ]
• Official Symbol: BGN
• Synonyms: BGN; biglycan; biglycan proteoglycan; DSPG1; SLRR1A; bone/cartilage proteoglycan I; bone/cartilage proteoglycan-I; small leucine-rich protein 1A; dermatan sulphate proteoglycan I; PGI; PG-S1
• Gene ID: 633
• mRNA Refseq: NM_001711
• Protein Refseq: NP_001702
• MIM: 301870
• UniProt ID: P21810