Recombinant Human BEND4 Protein, GST-Tagged

• Cat.No.: BEND4-0015H
• Product Overview: Human CCDC4 full-length ORF (AAI46594.1, 1 a.a. - 416 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: BEND4 (BEN Domain Containing 4) is a Protein Coding gene.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 72.71 kDa
• AA Sequence: MQGAPRARFGSRTPPAAAASSSSPSCTPATSQGHLRTPAQPPPASPAASSSSSFAAVVRYGPGAAAAAGTGGTGSDSASLELSAESRMILDAFAQQCSRVLSLLNCGGKLLDSNHSQSMISCVKQEGSSYNERQEHCHIGKGVHSQTSDNVDIEMQYMQRKQQTSAFLRVFTDSLQNYLLSGSFPTPNPSSASEYGHLADVDPLSTSPVHTLGGWTSPATSESHGHPSSSTLPEEEEEEDEEGYCPRCQELEQEVISLQQENEELRRKLESIPVPCQTVLDYLKMVLQHHNQLLIPQPADQPTEGSKQLLNNYPVYITSKQWDEAVNSSKKDGRRLLRYLIRFVFTTDELKYSCGLGKRKRSVQSGETGPERRPLDPVKVTCLRGTASFRSVSPSVISFHRIGCGSPRTSVQPSVF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BEND4 BEN domain containing 4 [ Homo sapiens ]
• Official Symbol: BEND4
• Synonyms: BEND4; BEN domain containing 4; CCDC4, coiled coil domain containing 4; BEN domain-containing protein 4; FLJ35632; FLJ43965; coiled-coil domain containing 4; coiled-coil domain-containing protein 4; CCDC4; MGC157807; MGC157808
• Gene ID: 389206
• mRNA Refseq: NM_001159547
• Protein Refseq: NP_001153019
• UniProt ID: Q6ZU67