Recombinant Human BDNF protein, GST-tagged

• Cat.No.: BDNF-2586H
• Product Overview: Recombinant Human BDNF protein(P23560)(137-237aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 137-237aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.5 kDa
• AA Sequence: ELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: BDNF brain-derived neurotrophic factor [ Homo sapiens ]
• Official Symbol: BDNF
• Synonyms: BDNF; brain-derived neurotrophic factor; neurotrophin; abrineurin; MGC34632
• Gene ID: 627
• mRNA Refseq: NM_001143805
• Protein Refseq: NP_001137277
• MIM: 113505
• UniProt ID: P23560