Recombinant Human BDNF Protein, His-tagged
Cat.No. : | BDNF-02H |
Product Overview : | Recombinant human BDNF protein (19-128a.a) fused to a 6 a.a His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 19-128 |
Description : | The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene. |
Form : | Filtered White lyophilized (freeze-dried) powder. |
AA Sequence : | APMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHHHHHH. |
Purity : | Greater than 95.0% as determined by SDS-PAGE. |
Notes : | Our products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
Stability : | Store lyophilized protein at -20 centigrade. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4 centigrade for a limited period of time; it does not show any change after two weeks at 4 centigrade. |
Storage Buffer : | BDNF filtered (0.4 μm) and lyophilized from 0.5mg/ml in PBS. |
Reconstitution : | It is recommended to add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. |
Shipping : | Shipped at Room temperature. |
Gene Name | BDNF brain derived neurotrophic factor [ Homo sapiens (human) ] |
Official Symbol | BDNF |
Synonyms | BDNF; brain derived neurotrophic factor; ANON2; BULN2; brain-derived neurotrophic factor; abrineurin; neurotrophin |
Gene ID | 627 |
mRNA Refseq | NM_170735 |
Protein Refseq | NP_733931 |
MIM | 113505 |
UniProt ID | P23560 |
◆ Recombinant Proteins | ||
BDNF-64H | Recombinant Human Brain-derived Neurotrophic Factor | +Inquiry |
BDNF-08H | Recombinant Active Human BDNF Protein, His-tagged(C-ter) | +Inquiry |
BDNF-04H | Active Recombinant Human BDNF Protein | +Inquiry |
BDNF-022H | Active Recombinant Human Brain Derived Neurotrophic Factor | +Inquiry |
BDNF-007H | Active Recombinant Human BDNF Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDNF-001MCL | Recombinant Mouse BDNF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BDNF Products
Required fields are marked with *
My Review for All BDNF Products
Required fields are marked with *
0
Inquiry Basket