Recombinant Human BCOR Protein, GST-tagged

• Cat.No.: BCOR-175H
• Product Overview: Human BCOR partial ORF ( NP_060215, 1361 a.a. - 1460 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene was identified as an interacting corepressor of BCL6, a POZ/zinc finger transcription repressor that is required for germinal center formation and may influence apoptosis. This protein selectively interacts with the POZ domain of BCL6, but not with eight other POZ proteins. Specific class I and II histone deacetylases (HDACs) have been shown to interact with this protein, which suggests a possible link between the two classes of HDACs. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRD
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BCOR BCL6 corepressor [ Homo sapiens ]
• Official Symbol: BCOR
• Synonyms: BCOR; BCL6 corepressor; BCL6 co repressor; BCL-6 corepressor; FLJ20285; KIAA1575; BCL6 co-repressor; BCL-6 interacting corepressor; MAA2; ANOP2; MCOPS2; FLJ38041; MGC71031; MGC131961
• Gene ID: 54880
• mRNA Refseq: NM_001123383
• Protein Refseq: NP_001116855
• MIM: 300485
• UniProt ID: Q6W2J9