Recombinant Human BCOR Protein, GST-tagged
Cat.No. : | BCOR-175H |
Product Overview : | Human BCOR partial ORF ( NP_060215, 1361 a.a. - 1460 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene was identified as an interacting corepressor of BCL6, a POZ/zinc finger transcription repressor that is required for germinal center formation and may influence apoptosis. This protein selectively interacts with the POZ domain of BCL6, but not with eight other POZ proteins. Specific class I and II histone deacetylases (HDACs) have been shown to interact with this protein, which suggests a possible link between the two classes of HDACs. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq] |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | RRFRKRPEPSSDYDLSPAKQEPKPFDRLQQLLPASQSTQLPCSSSPQETTQSRPMPPEARRLIVNKNAGETLLQRAARLGYEEVVLYCLENKICDVNHRD |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BCOR BCL6 corepressor [ Homo sapiens ] |
Official Symbol | BCOR |
Synonyms | BCOR; BCL6 corepressor; BCL6 co repressor; BCL-6 corepressor; FLJ20285; KIAA1575; BCL6 co-repressor; BCL-6 interacting corepressor; MAA2; ANOP2; MCOPS2; FLJ38041; MGC71031; MGC131961; |
Gene ID | 54880 |
mRNA Refseq | NM_001123383 |
Protein Refseq | NP_001116855 |
MIM | 300485 |
UniProt ID | Q6W2J9 |
◆ Recombinant Proteins | ||
BCOR-2361M | Recombinant Mouse BCOR Protein | +Inquiry |
BCOR-174H | Recombinant Human BCOR Protein, GST-tagged | +Inquiry |
BCOR-11661Z | Recombinant Zebrafish BCOR | +Inquiry |
BCOR-1004M | Recombinant Mouse BCOR Protein, His (Fc)-Avi-tagged | +Inquiry |
BCOR-1557HF | Recombinant Full Length Human BCOR Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BCOR-8473HCL | Recombinant Human BCOR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BCOR Products
Required fields are marked with *
My Review for All BCOR Products
Required fields are marked with *
0
Inquiry Basket